| Cat.No.: | PE-2093 |
| Background: | Histone methyltransferase that specifically trimethylates 'Lys-9' of histone H3. H3 'Lys-9' trimethylation represents a specific tag for epigenetic transcriptional repression by recruiting HP1 (CBX1, CBX3 and/or CBX5) proteins to methylated histones. Mainly functions in euchromatin regions, thereby playing a central role in the silencing of euchromatic genes. H3 'Lys-9' trimethylation is coordinated with DNA methylation. Probably forms a complex with MBD1 and ATF7IP that represses transcription and couples DNA methylation and histone 'Lys-9' trimethylation. Its activity is dependent on MBD1 and is heritably maintained through DNA replication by being recruited by CAF-1. SETDB1 is targeted to histone H3 by TRIM28/TIF1B, a factor recruited by KRAB zinc-finger proteins. |
| Applications: | ELISA; Western blot |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
| Alternative Names: | AU022152/EC 2.1.1.43/ERG-associated protein with SET domain |
| Tag: | GST |
| Amino Acid Sequence: | SSLPGCIGLDAATATVESEEIAELQQAVVEELGISMEELRHFIDEELEKM DCVQQRKKQLAELETWVIQKESEVAHVDQLFDDASRAVTNCESLVKDFY |
| Sequence Similarities: | Belongs to the histone-lysine methyltransferase family. Suvar3-9 subfamily.Contains 1 MBD (methyl-CpG-binding) domain.Contains 1 post-SET domain.Contains 1 pre-SET domain.Contains 1 SET domain.Contains 2 Tudor domains. |
| Expression System: | Wheat germ |
| Protein Length: | Protein fragment; 2 to 100 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Bioactive Small Molecules | ||
| BSM-0027 | UNC0321 (trifluoroacetate salt) | Inquiry |
| ◆ Antibodies | ||
| EAb-0030 | SETD8 Polyclonal Antibody | Inquiry |
| EAb-0031 | SETDB1 Polyclonal Antibody | Inquiry |
| EAb-0032 | Setd1a Polyclonal Antibody | Inquiry |
| EAb-0033 | Setd1b Polyclonal Antibody | Inquiry |
| Related Gene / Proteins | |||
| KMT1B | KMT1E | KMT2A | KMT2B |
| KMT2C | KMT2D | KMT2E | KMT3A |
| KMT3B | KMT3C | KMT5A | KMT6 |
| SENP3 | SENP8 | SET | SET1 |
| SET2 | SET7 | SET8 | SET9 More > |
| SETBP1 | SETD1A | SETD1B | SETD2 |
| SETD3 | SETD5 | SETD6 | SETD7 |
| SETD8 | SETD9 | SetDB1 | SETDB2 |
| SETMAR | |||
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools
Privacy Policy | Cookie Policy
Copyright © 2026 CD BioSciences. All Rights Reserved.