| Cat.No.: | PE-2089 |
| Background: | Plays a role in maintenance of the normal epithelial architecture through the repression of SNAI1 transcription in a histone deacetylase-dependent manner, and thus the regulation of E-cadherin levels. |
| Applications: | Western blot; ELISA |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
| Alternative Names: | 1110002J22Rik/fj99h01/KIAA1266 |
| Tag: | GST |
| Amino Acid Sequence: | LKMPTQSEEEKLSPSPTTEDPRVRSHVSRQAMQGMPVRNTGSPKSAVKTR QAFFLHTTYFTKFARQVCKNTLRLRQAARRPFVAINYAAIRAECKMLLNS |
| Sequence Similarities: | Contains 1 BAH domain.Contains 1 ELM2 domain.Contains 1 GATA-type zinc finger.Contains 1 SANT domain. |
| Expression System: | Wheat germ |
| Protein Length: | Protein fragment; 416 to 515 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Bioactive Small Molecules | ||
| BSM-0065 | 5’-Deoxy-5’-methylthioadenosine | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0165 | Recombinant Human MTF1 293 Cell Lysate | Inquiry |
| EL-0195 | Recombinant Human MTA1 293 Cell Lysate | Inquiry |
| ◆ Antibodies | ||
| EAb-0325 | MTF2 Polyclonal Antibody | Inquiry |
| ◆ Proteins & Enzymes | ||
| PE-0435 | Recombinant Human MTA2, GST-tagged | Inquiry |
| Related Gene / Proteins | |||
| MTA | MTA1 | MTA2 | MTA3 |
| MTF1 | MTF2 | MTR | |
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools
Privacy Policy | Cookie Policy
Copyright © 2026 CD BioSciences. All Rights Reserved.