Recombinant Human PRDM4/PFM1 protein


  • Specification
  • Related Products
Cat.No.:  PE-2082
Product Name:  Recombinant Human PRDM4/PFM1 protein
Background:  May function as a transcription factor involved in cell differentiation.
Applications:  Western blot; ELISA
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl
Alternative Names:  MGC45046/PFM 1/PFM1
Tag:  GST
Amino Acid Sequence:  IITTDENECNWMMFVRKARNREEQNLVAYPHDGKIFFCTSQDIPPENELL FYYSRDYAQQIGVPEHPDVHLCNCGKECNSYTEFKAHLTSHIHNHLPTQG
Sequence Similarities:  Contains 6 C2H2-type zinc fingers.Contains 1 SET domain.
Expression System:  Wheat germ
Protein Length:  Protein fragment; 476 to 575
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.