| Cat.No.: | PE-2082 |
| Product Name: | Recombinant Human PRDM4/PFM1 protein |
| Background: | May function as a transcription factor involved in cell differentiation. |
| Applications: | Western blot; ELISA |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
| Alternative Names: | MGC45046/PFM 1/PFM1 |
| Tag: | GST |
| Amino Acid Sequence: | IITTDENECNWMMFVRKARNREEQNLVAYPHDGKIFFCTSQDIPPENELL FYYSRDYAQQIGVPEHPDVHLCNCGKECNSYTEFKAHLTSHIHNHLPTQG |
| Sequence Similarities: | Contains 6 C2H2-type zinc fingers.Contains 1 SET domain. |
| Expression System: | Wheat germ |
| Protein Length: | Protein fragment; 476 to 575 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Bioactive Small Molecules | ||
| BSM-0027 | UNC0321 (trifluoroacetate salt) | Inquiry |
| BSM-0047 | SGC707 | Inquiry |
| ◆ Antibodies | ||
| EAb-0048 | PRMT6 Polyclonal Antibody | Inquiry |
| EAb-0049 | PRMT7 Polyclonal Antibody | Inquiry |
| EAb-0050 | PRMT1 Polyclonal Antibody | Inquiry |
| Related Gene / Proteins | |||
| PFM1 | Pr-SET7 | PRC1 | PRC2 |
| PRDM1 | PRDM10 | PRDM11 | PRDM12 |
| PRDM13 | PRDM14 | PRDM15 | PRDM16 |
| PRDM17 | PRDM2 | PRDM3 | PRDM4 |
| PRDM5 | PRDM6 | PRDM7 | PRDM8 More > |
| PRDM9 | PREP1 | PRIM2 | PRKAA2 |
| PRKCA | PRKCB | PRKCE | PRKDC |
| PRKRIP1 | PRMT | prmt1 | PRMT2 |
| PRMT3 | PRMT5 | prmt6 | PRMT7 |
| PRMT8 | PRMT9 | Progerin | Protamine 2 |
| Prox1 | PRPF31 | PRPF40A | PRSS12 |
| PRSS55 | PRTFDC1 | ||
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools
