| Cat.No.: | PE-2079 |
| Background: | Arginine methyltransferase that can both catalyze the formation of omega-N monomethylarginine (MMA) and symmetrical dimethylarginine (sDMA), with a preference for the formation of MMA. Specifically mediates the symmetrical dimethylation of arginine residues in the small nuclear ribonucleoproteins Sm D1 (SNRPD1) and Sm D3 (SNRPD3); such methylation being required for the assembly and biogenesis of snRNP core particles. Methylates SUPT5H. Mono- and dimethylates arginine residues of myelin basic protein (MBP) in vitro. Plays a role in the assembly of snRNP core particles. May play a role in cytokine-activated transduction pathways. Negatively regulates cyclin E1 promoter activity and cellular proliferation. May regulate the SUPT5H transcriptional elongation properties. May be part of a pathway that is connected to a chloride current, possibly through cytoskeletal rearrangement. Methylates histone H2A and H4 'Arg-3' during germ cell development. Methylates histone H3 'Arg-8', which may repress transcription. Methylates the Piwi proteins (PIWIL1, PIWIL2 and PIWIL4), methylation of Piwi proteins being required for the interaction with Tudor domain-containing proteins and subsequent localization to the meiotic nuage. Methylates RPS10. |
| Applications: | Western blot; ELISA |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
| Alternative Names: | 72 kDa ICln binding protein/72 kDa ICln-binding protein/ANM5_HUMAN |
| Tag: | GST |
| Amino Acid Sequence: | DNNRYCTLEFPVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWF PILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTG RSYTIGL |
| Sequence Similarities: | Belongs to the protein arginine N-methyltransferase family. |
| Expression System: | Wheat germ |
| Post Translational Modifications: | Disulfide bonds and non-covalent association mediate homooligomers formation. |
| Protein Length: | Protein fragment; 531 to 637 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Bioactive Small Molecules | ||
| BSM-0027 | UNC0321 (trifluoroacetate salt) | Inquiry |
| BSM-0047 | SGC707 | Inquiry |
| ◆ Antibodies | ||
| EAb-0048 | PRMT6 Polyclonal Antibody | Inquiry |
| EAb-0049 | PRMT7 Polyclonal Antibody | Inquiry |
| EAb-0050 | PRMT1 Polyclonal Antibody | Inquiry |
| Related Gene / Proteins | |||
| Pr-SET7 | PRC1 | PRC2 | PRDM1 |
| PRDM10 | PRDM11 | PRDM12 | PRDM13 |
| PRDM14 | PRDM15 | PRDM16 | PRDM17 |
| PRDM2 | PRDM3 | PRDM4 | PRDM5 |
| PRDM6 | PRDM7 | PRDM8 | PRDM9 More > |
| PREP1 | PRIM2 | PRKAA2 | PRKCA |
| PRKCB | PRKCE | PRKDC | PRKRIP1 |
| PRMT | prmt1 | PRMT2 | PRMT3 |
| PRMT5 | prmt6 | PRMT7 | PRMT8 |
| PRMT9 | Progerin | Protamine 2 | Prox1 |
| PRPF31 | PRPF40A | PRSS12 | PRSS55 |
| PRTFDC1 | |||
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools