| Cat.No.: | PE-2065 |
| Product Name: | Recombinant Mouse HDAC8 protein |
| Background: | Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. May play a role in smooth muscle cell contractility. |
| Applications: | SDS-PAGE |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 43 kDa including tags |
| Purity: | > 90 % SDS-PAGE. Purified by using conventional chromatography techniques. |
| Species: | Mouse |
| Formulation: | pH: 7.4; Constituents: 10% Glycerol, 90% PBS |
| Accession#: | Q8VH37 |
| Alternative Names: | CDA07/CDLS5/HD 8 |
| Tag: | His |
| Amino Acid Sequence: | MEMPEEPANSGHSLPPVYIYSPEYVSICDSLVKVPKRASMVHSLIEAYAL HKQMRIVKPKVASMEEMATFHTDAYLQHLQKVSQEGDEDHPDSIEYGLGY DCPATEGIFDYAAAIGGGTITAAQCLIDGKCKVAINWSGGWHHAKKDEAS GFCYLNDAVLGILRLRRKFDRILYVDLDLHHGDGVEDAFSFTSKVMTVSL HKFSPGFFPGTGDMSDVGLGKGRYYSVNVPIQDGIQDEKYYHICESVLKE VYQAFNPKAVVLQLGADTIAGDPMCSFNMTPVGIGKCLKYVLQWQLATLI LGGGGYNLANTARCWTYLTGVILGKTLSSEIPDHEFFTAYGPDYVLEITP SCRPDRNEPHRIQQILNYIKGNLKHVV |
| Sequence Similarities: | Belongs to the histone deacetylase family. HD type 1 subfamily. |
| Expression System: | Baculovirus-Insect Cells |
| Post Translational Modifications: | Phosphorylated by PKA on serine 39. Phosphorylation reduces deacetylase activity observed preferentially on histones H3 and H4. |
| Protein Length: | Full length protein; 1 to 377 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Extracts & Lysates | ||
| EL-0006 | Recombinant Human HDAC1 293 Cell Lysate | Inquiry |
| EL-0007 | Recombinant Human HDAC2 293 Cell Lysate | Inquiry |
| EL-0008 | Recombinant Human HDAC3 Cell Lysate | Inquiry |
| EL-0009 | Recombinant Human HDAC4 Cell Lysate | Inquiry |
| ◆ Bioactive Small Molecules | ||
| BSM-0007 | Tubacin | Inquiry |
| Related Gene / Proteins | |||
| HDAC | HDAC1 | HDAC10 | HDAC11 |
| HDAC2 | HDAC3 | hdac4 | hdac5 |
| HDAC6 | hdac7 | HDAC8 | hdac9 |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools