Recombinant Mouse HDAC8 protein


  • Specification
  • Related Products
Cat.No.:  PE-2065
Product Name:  Recombinant Mouse HDAC8 protein
Background:  Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. May play a role in smooth muscle cell contractility.
Applications:  SDS-PAGE
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  43 kDa including tags
Purity:  > 90 % SDS-PAGE. Purified by using conventional chromatography techniques.
Species:  Mouse
Formulation:  pH: 7.4; Constituents: 10% Glycerol, 90% PBS
Accession#:  Q8VH37
Alternative Names:  CDA07/CDLS5/HD 8
Tag:  His
Amino Acid Sequence:  MEMPEEPANSGHSLPPVYIYSPEYVSICDSLVKVPKRASMVHSLIEAYAL HKQMRIVKPKVASMEEMATFHTDAYLQHLQKVSQEGDEDHPDSIEYGLGY DCPATEGIFDYAAAIGGGTITAAQCLIDGKCKVAINWSGGWHHAKKDEAS GFCYLNDAVLGILRLRRKFDRILYVDLDLHHGDGVEDAFSFTSKVMTVSL HKFSPGFFPGTGDMSDVGLGKGRYYSVNVPIQDGIQDEKYYHICESVLKE VYQAFNPKAVVLQLGADTIAGDPMCSFNMTPVGIGKCLKYVLQWQLATLI LGGGGYNLANTARCWTYLTGVILGKTLSSEIPDHEFFTAYGPDYVLEITP SCRPDRNEPHRIQQILNYIKGNLKHVV
Sequence Similarities:  Belongs to the histone deacetylase family. HD type 1 subfamily.
Expression System:  Baculovirus-Insect Cells
Post Translational Modifications:  Phosphorylated by PKA on serine 39. Phosphorylation reduces deacetylase activity observed preferentially on histones H3 and H4.
Protein Length:  Full length protein; 1 to 377
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.