| Cat.No.: | PE-2052 |
| Product Name: | Recombinant Human KDM2B protein |
| Background: | Histone demethylase that demethylates 'Lys-4' and 'Lys-36' of histone H3, thereby playing a central role in histone code. Preferentially demethylates trimethylated H3 'Lys-4' and dimethylated H3 'Lys-36' residue while it has weak or no activity for mono- and tri-methylated H3 'Lys-36'. Preferentially binds the transcribed region of ribosomal RNA and represses the transcription of ribosomal RNA genes which inhibits cell growth and proliferation. May also serve as a substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex. |
| Applications: | Western blot; ELISA |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
| Accession#: | Q8NHM5 |
| Alternative Names: | [Histone-H3]-lysine-36 demethylase 1B/CXXC-type zinc finger protein 2/CXXC2 |
| Tag: | GST |
| Amino Acid Sequence: | LGKKPKAPALRFLKRTLSNESEESVKSTTLAVDYPKTPTGSPATEVSAKW THLTEFELKGLKALVEKLESLPENKKCVPEGIEDPQALLEGVKNVLKEH |
| Sequence Similarities: | Belongs to the JHDM1 histone demethylase family.Contains 1 CXXC-type zinc finger.Contains 1 F-box domain.Contains 1 JmjC domain.Contains 7 LRR (leucine-rich) repeats.Contains 1 PHD-type zinc finger. |
| Expression System: | Wheat germ |
| Protein Length: | Protein fragment; 457 to 555 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Cell Lines | ||
| CL-0015 | Human KDM5B Knockout Cell Line 14bp deletion | Inquiry |
| CL-0087 | Human KDM1A Knockout Cell Line 10bp deletion | Inquiry |
| CL-0088 | Human KDM1B Knockout Cell Line 13bp deletion | Inquiry |
| CL-0089 | Human KDM2B Knockout Cell Line 14bp deletion | Inquiry |
| ◆ Antibodies | ||
| EAb-0071 | KDM1B Polyclonal Antibody | Inquiry |
| Related Gene / Proteins | |||
| KDM1 | KDM1A | KDM1B | KDM2 |
| KDM2A | KDM2B | KDM3A | KDM3B |
| KDM4 | KDM4A | KDM4B | KDM4C |
| KDM4D | KDM4E | KDM5 | KDM5A |
| KDM5B | KDM5C | KDM5D | KDM6A More > |
| KDM6B | KDM6C | KDM7 | KDM7A |
| KDM7B | KDM8 | ||
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools
