Recombinant Human KDM2B protein


  • Specification
  • Related Products
Cat.No.:  PE-2052
Product Name:  Recombinant Human KDM2B protein
Background:  Histone demethylase that demethylates 'Lys-4' and 'Lys-36' of histone H3, thereby playing a central role in histone code. Preferentially demethylates trimethylated H3 'Lys-4' and dimethylated H3 'Lys-36' residue while it has weak or no activity for mono- and tri-methylated H3 'Lys-36'. Preferentially binds the transcribed region of ribosomal RNA and represses the transcription of ribosomal RNA genes which inhibits cell growth and proliferation. May also serve as a substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.
Applications:  Western blot; ELISA
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl
Accession#:  Q8NHM5
Alternative Names:  [Histone-H3]-lysine-36 demethylase 1B/CXXC-type zinc finger protein 2/CXXC2
Tag:  GST
Amino Acid Sequence:  LGKKPKAPALRFLKRTLSNESEESVKSTTLAVDYPKTPTGSPATEVSAKW THLTEFELKGLKALVEKLESLPENKKCVPEGIEDPQALLEGVKNVLKEH
Sequence Similarities:  Belongs to the JHDM1 histone demethylase family.Contains 1 CXXC-type zinc finger.Contains 1 F-box domain.Contains 1 JmjC domain.Contains 7 LRR (leucine-rich) repeats.Contains 1 PHD-type zinc finger.
Expression System:  Wheat germ
Protein Length:  Protein fragment; 457 to 555
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.