Recombinant human SET7 protein


  • Specification
  • Related Products
Cat.No.:  PE-2047
Background:  Histone methyltransferase that specifically monomethylates 'Lys-4' of histone H3. H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation. Plays a central role in the transcriptional activation of genes such as collagenase or insulin. Recruited by IPF1/PDX-1 to the insulin promoter, leading to activate transcription. Has also methyltransferase activity toward non-histone proteins such as p53/TP53, TAF10, and possibly TAF7 by recognizing and binding the [KR]-[STA]-K in substrate proteins. Monomethylates 'Lys-189' of TAF10, leading to increase the affinity of TAF10 for RNA polymerase II. Monomethylates 'Lys-372' of p53/TP53, stabilizing p53/TP53 and increasing p53/TP53-mediated transcriptional activation. Also able to demethylated 'Lys-372' of p53/TP53 in vitro.
Applications:  SDS-PAGE; Western blot; Functional Studies
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  75 kDa including tags
Purity:  > 95 % SDS-PAGE.
Species:  Human
Formulation:  pH: 7.50; Constituents: 0.31% Glutathione, 0.002% PMSF, 0.004% DTT, 0.79% Tris HCl, 0.003% EDTA, 25% Glycerol, 0.88% Sodium chloride
Accession#:  Q8WTS6
Alternative Names:  FLJ21193/H3 K4 HMTase/H3-K4-HMTase SETD7
Amino Acid Sequence:  MDSDDEMVEEAVEGHLDDDGLPHGFCTVTYSSTDRFEGNFVHGEKNGRGK FFFFDGSTLEGYYVDDALQGQGVYTYEDGGVLQGTYVDGELNGPAQEYDT DGRLIFKGQYKDNIRHGVCWIYYPDGGSLVGEVNEDGEMTGEKIAYVYPD ERTALYGKFIDGEMIEGKLATLMSTEEGRPHFELMPGNSVYHFDKSTSSC ISTNALLPDPYESERVYVAESLISSAGEGLFSKVAVGPNTVMSFYNGVRI THQEVDSRDWALNGNTLSLDEETVIDVPEPYNHVSKYCASLGHKANHSFT PNCIYDMFVHPRFGPIKCIRTLRAVEADEELTVAYGYDHSPPGKSGPEAP EWYQVELKAFQATQQK
Sequence Similarities:  Belongs to the histone-lysine methyltransferase family. SET7 subfamily.Contains 3 MORN repeats.Contains 1 SET domain.
Expression System:  Sf9 Insect Cells
Protein Length:  Full length protein; 1 to 366
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

Get Free Quote

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Copyright © CD BioSciences. All Rights Reserved.
0
Shopping Cart